PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010558667.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 423aa    MW: 46934.2 Da    PI: 7.475
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010558667.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-165195147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT  E++++v+a kq+G   W++I +++g ++t+ q++s+ qk+
   XP_010558667.1 51 RERWTDGEHKKFVEALKQYGRA-WRRIQEHIG-TKTAVQIRSHAQKF 95
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.47E-1545101IPR009057Homeodomain-like
PROSITE profilePS5129418.03346100IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-84897IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-154998IPR006447Myb domain, plants
SMARTSM007176.3E-125098IPR001005SANT/Myb domain
PfamPF002491.1E-125194IPR001005SANT/Myb domain
CDDcd001671.38E-85396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MASSSSAMTV QGTFRGAHLN KAPMMQLNEQ ISGGNNSASK ARKPYTITKE RERWTDGEHK  60
KFVEALKQYG RAWRRIQEHI GTKTAVQIRS HAQKFFSKIA RETAGSNGSS VERIVIPPPR  120
PKRKPMHPYP RKLGNPSAKE ISGTDQSRRS VSPPDLSVSE GDDQSPTSVL SSVCSDAFGS  180
ADTNSPNSIL SPVSSTLPCE LTLSGPYGST TTFAIEEAES LTLELFGRER RLLSREESIN  240
PPKKQSLKLF GKTVEVKDTC CTRSPLDSNE EKPIQPFLWK LSPEENILCW IQKHKQEGEN  300
SNGLEPRNLD AKEGGHQEEG SSGGSNSCGS DDDDDTDRGE ADKDSEVEEE TPTTSHERKE  360
IGVPEFKRSE RSAFRQLKGT RPELQTKAFV PYKKRKMGIE TEDRYSGKRR ETGEDGDICL  420
LCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227234RERRLLSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010558667.10.0PREDICTED: protein REVEILLE 1-like isoform X1
SwissprotF4KGY61e-96RVE1_ARATH; Protein REVEILLE 1
TrEMBLE4MX623e-97E4MX62_EUTHA; mRNA, clone: RTFL01-17-B24
TrEMBLV4N7S53e-97V4N7S5_EUTSA; Uncharacterized protein
STRINGAT5G17300.13e-94(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63562644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-79MYB_related family protein